PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi3g46690.1.p
Common NameBRADI_3g46690
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family EIL
Protein Properties Length: 477aa    MW: 52242.8 Da    PI: 4.7103
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi3g46690.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3354.32.4e-108593642316
                       XXXXXXXXXXXXXXXXXXXXXX..XXXXX..XXXXXXX...........XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
              EIN3   2 elkkrmwkdqmllkrlkerkkqlledkeaa.tgakksn...........ksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgk 82 
                       +lkkrmwkdqmll +l++r   +  +  ++ t+++  +               q rrk+m raQDg+L++Ml++me+cna+GfvYg i+e g+
  Bradi3g46690.1.p  59 DLKKRMWKDQMLLTKLEGRAGARGVAGPPSrTSSTA-SsssgsglqaeeSLDVQCRRKAMLRAQDGVLRHMLRMMEACNARGFVYGVIDEAGE 150
                       9******************99877665555422222.2356888877767788**************************************** PP

                       XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH--- CS
              EIN3  83 pvegasdsLraWWkekvefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPt 175
                       p++g+sdsLr+WWke+v+fdr+gp+ ++       +  g+s l     s   +l+++qD+tlgS+Lsal+qhc+ppqr+fple+g++pPWWPt
  Bradi3g46690.1.p 151 PMSGSSDSLRGWWKENVSFDRAGPMGLVGP-----V--GDSPLG--LASCLYRLQDIQDSTLGSVLSALIQHCEPPQRSFPLERGLAPPWWPT 234
                       ****************************99.....3..445552..4677899**************************************** PP

                       S--HHHHHHT.--TT--.-----GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXXXX.X CS
              EIN3 176 Gkelwwgelg.lskdqgtppykkphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsahss.s 266
                       G+e wwg++g +++ qg ppy+kphdlkkawk+s+L+avikhmsp+++++r+l++qsk+lq+kmsakes ++++vl+qee++  +++a+ + s
  Bradi3g46690.1.p 235 GHEPWWGTQGeMQAYQGVPPYRKPHDLKKAWKISLLSAVIKHMSPRFDQMRKLVWQSKRLQQKMSAKESETWSKVLRQEEALSGRLKASLQiS 327
                       *********************************************************************************998888875422 PP

                       XXXXXXXXXXXXXXXXXXXXXXXXX.XXXXXXXXXXXXXXXXXXXXXXXX CS
              EIN3 267 lrkqspkvtlsceqkedvegkkeskikhvqavkttagfpvvrkrkkkpse 316
                          q  +   ++e+k+d  +k++ +   vq++k++++++          +
  Bradi3g46690.1.p 328 ---QLDDDEEEEEDKKDMGEKDDLEGVGVQQDKRKREVS----------R 364
                       ...333333333333333344444444444444433222..........2 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048732.2E-11159314No hitNo description
Gene3DG3DSA:1.10.3180.101.0E-63190322IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167682.09E-56193316IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 477 aa     Download sequence    Send to blast
MGKGIRVKRR FTEESVMEHE DAPGVAGGGP APADDLEALE QPEEISDSES GSESLEISDL  60
KKRMWKDQML LTKLEGRAGA RGVAGPPSRT SSTASSSSGS GLQAEESLDV QCRRKAMLRA  120
QDGVLRHMLR MMEACNARGF VYGVIDEAGE PMSGSSDSLR GWWKENVSFD RAGPMGLVGP  180
VGDSPLGLAS CLYRLQDIQD STLGSVLSAL IQHCEPPQRS FPLERGLAPP WWPTGHEPWW  240
GTQGEMQAYQ GVPPYRKPHD LKKAWKISLL SAVIKHMSPR FDQMRKLVWQ SKRLQQKMSA  300
KESETWSKVL RQEEALSGRL KASLQISQLD DDEEEEEDKK DMGEKDDLEG VGVQQDKRKR  360
EVSRSGSGSG SSVQNEKYTL QPTAGGSREL TIMLPDQLAA TDQASRSPID ELMKLYYSCI  420
QGAGESYGDR GKEEDMAALV SPLVLGGAID EVAQDVLFDI IGSCPEVDDV LRLMGE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4zds_A4e-481903201130Protein ETHYLENE INSENSITIVE 3
4zds_B4e-481903201130Protein ETHYLENE INSENSITIVE 3
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703060.0HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003572648.10.0PREDICTED: ETHYLENE INSENSITIVE 3-like 5 protein
SwissprotQ9LX161e-91EIL4_ARATH; Putative ETHYLENE INSENSITIVE 3-like 4 protein
TrEMBLA0A0Q3FK460.0A0A0Q3FK46_BRADI; Uncharacterized protein
STRINGBRADI3G46690.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP63838168
Representative plantOGRP5631682
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65100.11e-86EIL family protein